HPA003016

DACT1 antibody from Sigma-Aldrich
DAPPER, DAPPER1, FRODO, HDPR1, THYEX3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003016
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003016, RRID:AB_1078623
Product name
Anti-DACT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003016
Antibody type
Polyclonal
Antigen
Dapper homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPLPYASPYAYVASDSEYSAECESLFHSTVVDTSE
DEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEE
SGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIK
ASHNLKKKILRFRSGS
Storage
-20C
Provider Type Product Number
- No reagents -