Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006774-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006774-M02, RRID:AB_489865
- Product name
- STAT3 monoclonal antibody (M02), clone 4D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STAT3.
- Antigen sequence
LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPY
LKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNN
GEGAEPSAGGQFESLTFDMELTSECATSPM- Isotype
- IgG
- Antibody clone number
- 4D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Acetylation directs survivin nuclear localization to repress STAT3 oncogenic activity.
Wang H, Holloway MP, Ma L, Cooper ZA, Riolo M, Samkari A, Elenitoba-Johnson KS, Chin YE, Altura RA
The Journal of biological chemistry 2010 Nov 12;285(46):36129-37
The Journal of biological chemistry 2010 Nov 12;285(46):36129-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STAT3 monoclonal antibody (M02), clone 4D6 Western Blot analysis of STAT3 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STAT3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STAT3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between NFKB1 and STAT3. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-STAT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)