Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405147 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STAT3 antibody: synthetic peptide directed towards the N terminal of human STAT3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAP
WIESQ DWAYAASKES- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Bone marrow mesenchymal stromal cells with support of bispecific antibody and ultrasound-mediated microbubbles prevent myocardial fibrosis via the signal transducer and activators of transcription signaling pathway.
The IL-6 family of cytokines modulates STAT3 activation by desumoylation of PML through SENP1 induction.
Deng W, Chen QW, Li XS, Liu H, Niu SQ, Zhou Y, Li GQ, Ke DZ, Mo XG
Cytotherapy 2011 Apr;13(4):431-40
Cytotherapy 2011 Apr;13(4):431-40
The IL-6 family of cytokines modulates STAT3 activation by desumoylation of PML through SENP1 induction.
Ohbayashi N, Kawakami S, Muromoto R, Togi S, Ikeda O, Kamitani S, Sekine Y, Honjoh T, Matsuda T
Biochemical and biophysical research communications 2008 Jul 11;371(4):823-8
Biochemical and biophysical research communications 2008 Jul 11;371(4):823-8
No comments: Submit comment
No validations: Submit validation data