HPA001671

STAT3 antibody from Sigma-Aldrich
APRF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001671
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001671, RRID:AB_1080102
Product name
Anti-STAT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001671
Antibody type
Polyclonal
Antigen
Signal transducer and activator of transcription 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAE
IIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYC
RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI
DLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTF
DMELTSECA
Storage
-20C
Provider Type Product Number
- No reagents -