Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006778-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006778-M01A, RRID:AB_1581044
- Product name
- STAT6 monoclonal antibody (M01A), clone 6C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STAT6.
- Antigen sequence
PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPS
LGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCS
DVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPT
EQD- Isotype
- IgG
- Antibody clone number
- 6C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STAT6 monoclonal antibody (M01A), clone 6C10 Western Blot analysis of STAT6 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STAT6 expression in transfected 293T cell line by STAT6 monoclonal antibody (M01A), clone 6C10.Lane 1: STAT6 transfected lysate(94.1 KDa).Lane 2: Non-transfected lysate.