HPA001861

STAT6 antibody from Atlas Antibodies
D12S1644, IL-4-STAT
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001861
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001861, RRID:AB_611813
Product name
Anti-STAT6
Provider product page
Atlas Antibodies - HPA001861
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMP
PSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLL
CSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLP
PTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQ
SGISMSHMDLR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -