HPA001861

STAT6 antibody from Sigma-Aldrich
D12S1644, IL-4-STAT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001861
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001861, RRID:AB_1080106
Product name
Anti-STAT6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001861
Antibody type
Polyclonal
Antigen
Signal transducer and activator of transcription 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMP
PSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLL
CSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLP
PTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQ
SGISMSHMDLR
Storage
-20C
Provider Type Product Number
- No reagents -