HPA001864

VAV1 antibody from Sigma-Aldrich
VAV
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001864
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001864, RRID:AB_1858722
Product name
Anti-VAV1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001864
Antibody type
Polyclonal
Antigen
Proto-oncogene vav recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQI
DDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVS
MPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQH
FLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEM
KEAL
Storage
-20C
Provider Type Product Number
- No reagents -