Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404851 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Amyloid beta (A4) Precursor Protein (APP) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-APP antibody: synthetic peptide directed towards the middle region of human APP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSD
DVLAN MISEPRISYG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Plasma amyloid beta-protein and C-reactive protein in relation to the rate of progression of Alzheimer disease.
Locascio JJ, Fukumoto H, Yap L, Bottiglieri T, Growdon JH, Hyman BT, Irizarry MC
Archives of neurology 2008 Jun;65(6):776-85
Archives of neurology 2008 Jun;65(6):776-85
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Sample Type: Mouse hippo campus Primary Antibody Dilution: 1:100Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:000 Color/Signal Descriptions: App: Red Nucleus: Blue Gene Name: APP Submitted by: Teresa Gunn