HPA001462

APP antibody from Sigma-Aldrich
AD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001462
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001462, RRID:AB_1078185
Product name
Anti-APP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001462
Antibody type
Polyclonal
Antigen
Amyloid beta A4 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANMISEPRISYGNDALMPSLTETKTTVELLPVNGE
FSLDDLQPWHSFGADSVPANTENEVEPVDARPAAD
RGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYE
VHHQKLVFFAKDVGSN
Storage
-20C
Provider Type Product Number
- No reagents -