Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28409 - Provider product page
- Provider
- Abnova Corporation
- Product name
- TRIB2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant TRIB2.
- Antigen sequence
TIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLG
SPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAV
HLHSGEELVCKVFDISCYQESLAPCFCLSAHSNIN
QITEIILGETKAYVFFERSYGDMHSFVRTCKKLRE- Isotype
- IgG
- Storage
- Store at 4 °C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using TRIB2 polyclonal antibody (Cat # PAB28409).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of lane 1: NIH-3T3 cell lysate and lane 2: NBT-II cell lysate using TRIB2 polyclonal antibody (Cat # PAB28409).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of U251 MG cell line with TRIB2 polyclonal antibody (Cat # PAB28409) shows positivity in nucleus but not nucleoli and cytoplasm. Fixation/Permeabilization: PFA/Triton X-100
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human spleen with TRIB2 polyclonal antibody (Cat # PAB28409) shows strong cytoplasmic positivity in cells in red pulp and white pulp.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)