Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00028951-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00028951-M04, RRID:AB_566246
- Product name
- TRIB2 monoclonal antibody (M04), clone 1B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIB2.
- Antigen sequence
FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSI
LRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKE
VSDQLVPDVNMEENLDPFFN- Isotype
- IgG
- Antibody clone number
- 1B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TRIB2 inhibits Wnt/β-Catenin/TCF4 signaling through its associated ubiquitin E3 ligases, β-TrCP, COP1 and Smurf1, in liver cancer cells.
Ubiquitin E3 ligase SCF(β-TRCP) regulates TRIB2 stability in liver cancer cells.
Impaired phosphorylation and ubiquitination by p70 S6 kinase (p70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promote tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer.
Xu S, Tong M, Huang J, Zhang Y, Qiao Y, Weng W, Liu W, Wang J, Sun F
FEBS letters 2014 Nov 28;588(23):4334-41
FEBS letters 2014 Nov 28;588(23):4334-41
Ubiquitin E3 ligase SCF(β-TRCP) regulates TRIB2 stability in liver cancer cells.
Qiao Y, Zhang Y, Wang J
Biochemical and biophysical research communications 2013 Nov 22;441(3):555-9
Biochemical and biophysical research communications 2013 Nov 22;441(3):555-9
Impaired phosphorylation and ubiquitination by p70 S6 kinase (p70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promote tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer.
Wang J, Zhang Y, Weng W, Qiao Y, Ma L, Xiao W, Yu Y, Pan Q, Sun F
The Journal of biological chemistry 2013 Nov 22;288(47):33667-33681
The Journal of biological chemistry 2013 Nov 22;288(47):33667-33681
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TRIB2 expression in transfected 293T cell line by TRIB2 monoclonal antibody (M04), clone 1B1.Lane 1: TRIB2 transfected lysate(38.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TRIB2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol