Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009097-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009097-M04, RRID:AB_535092
- Product name
- USP14 monoclonal antibody (M04), clone 6D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant USP14.
- Antigen sequence
PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGR
SSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDIL
RLSGGGDWHIAYVLLYGPRRVEIMEEESEQ- Isotype
- IgG
- Antibody clone number
- 6D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ubiquitin-specific protease-14 reduces cellular aggregates and protects against mutant huntingtin-induced cell degeneration: involvement of the proteasome and ER stress-activated kinase IRE1α.
Hyrskyluoto A, Bruelle C, Lundh SH, Do HT, Kivinen J, Rappou E, Reijonen S, Waltimo T, Petersén Å, Lindholm D, Korhonen L
Human molecular genetics 2014 Nov 15;23(22):5928-39
Human molecular genetics 2014 Nov 15;23(22):5928-39
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of USP14 expression in transfected 293T cell line by USP14 monoclonal antibody (M04), clone 6D6.Lane 1: USP14 transfected lysate(56.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged USP14 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to USP14 on HeLa cell. [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol