HPA001308

USP14 antibody from Sigma-Aldrich
TGT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001308
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001308, RRID:AB_1080499
Product name
Anti-USP14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001308
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVS
FRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPF
SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSW
VKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHI
AYVL
Storage
-20C
Provider Type Product Number
- No reagents -