HPA007722

PDE8A antibody from Atlas Antibodies
HsT19550

Antibody data

Product number
HPA007722
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007722, RRID:AB_1855130
Product name
Anti-PDE8A
Provider product page
Atlas Antibodies - HPA007722
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TTMGYQSGELIGKELGEVPINEKKADLLDTINSCI
RIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQGGK
IRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTG
KHKDRRKGSLDVKAVASRATEVSSQRRHSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.