HPA001312

TAP2 antibody from Sigma-Aldrich
ABCB3, D6S217E, PSF2, RING11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001312
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001312, RRID:AB_1080206
Product name
Anti-TAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001312
Antibody type
Polyclonal
Antigen
Antigen peptide transporter 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC
YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDK
VMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAG
QKQRLAIARALVRDPRVLILDEATSALDVQCEQA
Storage
-20C
Provider Type Product Number
- No reagents -