Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AM01263BT-S - Provider product page
- Provider
- Acris Antibodies GmbH
- Proper citation
- Acris Antibodies GmbH Cat#AM01263BT-S, RRID:AB_1624636
- Product name
- anti ZAP70
- Antibody type
- Monoclonal
- Antigen
- A KLH conjugated peptide "PQRRIDTLNSDGYTPEPARITSPDKPRPMP" corresponding to amino acid residues 280-309 of human ZAP70.
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Antibody clone number
- SBZAP
- Vial size
- 25 µg
- Concentration
- 0.1 mg/ml
No comments: Submit comment
No validations: Submit validation data