Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN2024350 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-zeta-Chain (TCR) Associated Protein Kinase 70kDa (ZAP70) (AA 280-309) antibody (Biotin)
- Antibody type
- Monoclonal
- Antigen
- A KLH conjugated peptide \"PQRRIDTLNSDGYTPEPARITSPDKPRPMP\" corresponding to amino acid residues 280-309 of human ZAP70.
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Biotin
- Epitope
- AA 280-309
- Isotype
- IgG
- Antibody clone number
- SBZAP
- Vial size
- 25 μg
- Concentration
- 0.1 mg/mL
- Storage
- Keep as concentrated solution. Aliquot and store at -20°C or below.
- Handling
- Avoid multiple freeze-thaw cycles. Do NOT add Sodium Azide! Use of Sodium Azide will inhibit enzyme activity of horseradish peroxidase.
No comments: Submit comment
No validations: Submit validation data