HPA003134

ZAP70 antibody from Atlas Antibodies
SRK, STD, ZAP-70
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003134
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003134, RRID:AB_1080629
Product name
Anti-ZAP70
Provider product page
Atlas Antibodies - HPA003134
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHP
QRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVY
ESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFG
SVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -