HPA003134

ZAP70 antibody from Sigma-Aldrich
SRK, STD, ZAP-70
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003134
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003134, RRID:AB_1080629
Product name
Anti-ZAP70 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003134
Antibody type
Polyclonal
Antigen
Tyrosine-protein kinase ZAP-70 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHP
QRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVY
ESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFG
SVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
Storage
-20C
Provider Type Product Number
- No reagents -