Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183429 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STAT1 antibody: synthetic peptide directed towards the N terminal of mouse STAT1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
QLQSWFTIVAETLQQIRQQLKKLEELEQKFTYEPD
PITKN KQVLSDRTFL- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references STAT1 in peripheral tissue differentially regulates homing of antigen-specific Th1 and Th2 cells.
Mikhak Z, Fleming CM, Medoff BD, Thomas SY, Tager AM, Campanella GS, Luster AD
Journal of immunology (Baltimore, Md. : 1950) 2006 Apr 15;176(8):4959-67
Journal of immunology (Baltimore, Md. : 1950) 2006 Apr 15;176(8):4959-67
No comments: Submit comment
No validations: Submit validation data