Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309693 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STAT1 antibody: synthetic peptide directed towards the N terminal of human STAT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
MCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVA
KSDQK QEQLLLKKMY- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Bone marrow mesenchymal stromal cells with support of bispecific antibody and ultrasound-mediated microbubbles prevent myocardial fibrosis via the signal transducer and activators of transcription signaling pathway.
Signal transducer and activator of transcription 1 activation in endothelial cells is a negative regulator of angiogenesis.
Deng W, Chen QW, Li XS, Liu H, Niu SQ, Zhou Y, Li GQ, Ke DZ, Mo XG
Cytotherapy 2011 Apr;13(4):431-40
Cytotherapy 2011 Apr;13(4):431-40
Signal transducer and activator of transcription 1 activation in endothelial cells is a negative regulator of angiogenesis.
Battle TE, Lynch RA, Frank DA
Cancer research 2006 Apr 1;66(7):3649-57
Cancer research 2006 Apr 1;66(7):3649-57
No comments: Submit comment
No validations: Submit validation data