Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309922 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STAT1 antibody: synthetic peptide directed towards the C terminal of human STAT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
DGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSP
EEFDE VSRIVGSVEF- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Signal transducer and activator of transcription 1 activation in endothelial cells is a negative regulator of angiogenesis.
Battle TE, Lynch RA, Frank DA
Cancer research 2006 Apr 1;66(7):3649-57
Cancer research 2006 Apr 1;66(7):3649-57
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting