Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [5]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000982 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000982, RRID:AB_1080099
- Product name
- Anti-STAT1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLRFSESSREGAITFTWVERSQNGGEPDFHAVEPY
TKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYP
NIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKT
ELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVG
SVE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and HEK293 using Anti-STAT1 antibody. Corresponding STAT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-STAT1 antibody HPA000982 (A) shows similar pattern to independent antibody HPA000931 (B).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
- Sample type
- MOUSE, RAT
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431Lane 5: Human liver tissueLane 6: Human tonsil tissue
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows cytoplasmic positivity in non-germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in non-germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in cells in distal tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in a subset of myocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in lymphoid cells.
- Sample type
- HUMAN