HPA000982

STAT1 antibody from Atlas Antibodies
ISGF-3, STAT91
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000982
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000982, RRID:AB_1080099
Product name
Anti-STAT1
Provider product page
Atlas Antibodies - HPA000982
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLRFSESSREGAITFTWVERSQNGGEPDFHAVEPY
TKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYP
NIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKT
ELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVG
SVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -