Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN212277 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A 39 residue synthetic peptide VHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV based on the human STAT1alpha (residues 712-750) was synthesized and the peptide coupled to KLH. The sequence differs from that of mouse by four amino acids. The carboxy terminal 38.
- Description
- Purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- C-Term
- Isotype
- IgG
- Vial size
- 25 μg
No comments: Submit comment
No validations: Submit validation data