HPA000931

STAT1 antibody from Sigma-Aldrich
ISGF-3, STAT91
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000931
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000931, RRID:AB_1080100
Product name
Anti-STAT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000931
Antibody type
Polyclonal
Antigen
Signal transducer and activator of transcription 1-alpha/beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSG
NIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSL
EDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLL
LKKMYLMLDNKRKEVVHKIIELLNVTELTQNA
Storage
-20C
Provider Type Product Number
- No reagents -