HPA001595

DNMT3B antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001595
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001595, RRID:AB_1847814
Product name
Anti-DNMT3B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001595
Antibody type
Polyclonal
Antigen
DNA (cytosine-5)-methyltransferase 3B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEPSPEPPSLESMKGDTRHLNGEEDAGGREDSILV
NGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKR
EVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRE
TRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQ
GRNHVDES
Storage
-20C
Provider Type Product Number
- No reagents -