HPA024292

FBXO43 antibody from Sigma-Aldrich
Fbx43
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024292
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024292, RRID:AB_1848462
Product name
Anti-FBXO43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024292
Antibody type
Polyclonal
Antigen
F-box only protein 43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILPRKEKDKTPELCETPKISGKKCLPRRRLNVSFA
LLKGDFESQNSSLESSISQVINLEKNIPSSASGFS
RANNFSPLVTSTLKTEEVTSCSQKLRLNFSQQKTS
TIDDSKD
Storage
-20C
Provider Type Product Number
- No reagents -