HPA003563

C3 antibody from Sigma-Aldrich
ARMD9, C3a, C3b, CPAMD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003563
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003563, RRID:AB_1847117
Product name
Anti-C3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003563
Antibody type
Polyclonal
Antigen
Complement C3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELN
LDVSLQLPSRSSKITHRIHWESASLLRSEETKENE
GFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDL
KVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDA
TMS
Storage
-20C
Provider Type Product Number
- No reagents -