HPA001143

CFI antibody from Sigma-Aldrich
C3b-INA, FI, IF, KAF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001143
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001143, RRID:AB_1078555
Product name
Anti-CFI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001143
Antibody type
Polyclonal
Antigen
Complement factor I precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKR
IVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNK
KDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREK
DNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECA
GTYDG
Storage
-20C
Provider Type Product Number
- No reagents -