HPA005688

CASP8 antibody from Atlas Antibodies
Casp-8, FLICE, MACH, MCH5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005688
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005688, RRID:AB_1846056
Product name
Anti-CASP8
Provider product page
Atlas Antibodies - HPA005688
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEE
LCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYC
LIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALT
TTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSN
MDCFICC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -