HPA001302

CASP8 antibody from Sigma-Aldrich
Casp-8, FLICE, MACH, MCH5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001302
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001302, RRID:AB_1846057
Product name
Anti-CASP8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001302
Antibody type
Polyclonal
Antigen
Caspase-8 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVF
FIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQT
RYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSL
CQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMG
KQMPQP
Storage
-20C
Provider Type Product Number
- No reagents -