HPA002024

FGR antibody from Sigma-Aldrich
c-fgr, p55c-fgr, SRC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002024
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002024, RRID:AB_1078503
Product name
Anti-FGR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002024
Antibody type
Polyclonal
Antigen
Proto-oncogene tyrosine-protein kinase FGR recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDP
TKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRG
VSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILN
NTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQAEE
WYFGKIG
Storage
-20C
Provider Type Product Number
- No reagents -