HPA001214

SNAP23 antibody from Atlas Antibodies
HsT17016, SNAP23A, SNAP23B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001214
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001214, RRID:AB_1080037
Product name
Anti-SNAP23
Provider product page
Atlas Antibodies - HPA001214
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFES
GKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQP
TTGAASGGYIKRITNDAREDEMEENLTQVGSILGN
LKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDI
ANA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -