HPA001214

SNAP23 antibody from Sigma-Aldrich
HsT17016, SNAP23A, SNAP23B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001214
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001214, RRID:AB_1080037
Product name
Anti-SNAP23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001214
Antibody type
Polyclonal
Antigen
Synaptosomal-associated protein 23 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFES
GKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQP
TTGAASGGYIKRITNDAREDEMEENLTQVGSILGN
LKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDI
ANA
Storage
-20C
Provider Type Product Number
- No reagents -