Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Proximity ligation assay [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005295-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005295-M01, RRID:AB_581643
- Product name
- PIK3R1 monoclonal antibody (M01), clone 3A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PIK3R1.
- Antigen sequence
MYNTVWNMEDLDLEYAKTDINCGTDLMFYIEMDPP
ALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISR
EEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKG
GNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRN
ESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAV
GKKLHKYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKRE
GNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLK
KQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLT
QKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHD
EKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQG
CYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSS
LKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR- Isotype
- IgG
- Antibody clone number
- 3A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PIK3R1 monoclonal antibody (M01), clone 3A10. Western Blot analysis of PIK3R1 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PIK3R1 expression in transfected 293T cell line by PIK3R1 monoclonal antibody (M01), clone 3A10.Lane 1: PIK3R1 transfected lysate (Predicted MW: 50 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PIK3R1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PIK3R1 transfected lysate using anti-PIK3R1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PIK3R1 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CRKL and PIK3R1. Mahlavu cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-PIK3R1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between EGFR and PIK3R1. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-PIK3R1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between FLT1 and PIK3R1. Huh7 cells were stained with anti-FLT1 rabbit purified polyclonal 1:1200 and anti-PIK3R1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)