HPA001216

PIK3R1 antibody from Atlas Antibodies
GRB1, p85, p85-ALPHA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001216
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001216, RRID:AB_1079612
Product name
Anti-PIK3R1
Provider product page
Atlas Antibodies - HPA001216
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSS
EEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLS
QTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENL
IKVIEILISTEWNERQPAPALPPKPPKPTTVANNG
MNNNMSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -