HPA001216

PIK3R1 antibody from Atlas Antibodies
GRB1, p85, p85-ALPHA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001216
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001216, RRID:AB_888714
Product name
Anti-PIK3R1
Provider product page
Atlas Antibodies - HPA001216
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSS
EEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLS
QTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENL
IKVIEILISTEWNERQPAPALPPKPPKPTTVANNG
MNNNMSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -