HPA001216

PIK3R1 antibody from Sigma-Aldrich
GRB1, p85, p85-ALPHA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001216
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001216, RRID:AB_1079612
Product name
Anti-PIK3R1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001216
Antibody type
Polyclonal
Antigen
Phosphatidylinositol 3-kinase regulatory subunit alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSS
EEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLS
QTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENL
IKVIEILISTEWNERQPAPALPPKPPKPTTVANNG
MNNNMSL
Storage
-20C
Provider Type Product Number
- No reagents -