Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005747-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005747-M01, RRID:AB_463794
- Product name
- PTK2 monoclonal antibody (M01), clone 2C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTK2.
- Antigen sequence
EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIY
PGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDL
RGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEER
FLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ- Isotype
- IgG
- Antibody clone number
- 2C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references JNK pathway-associated phosphatase dephosphorylates focal adhesion kinase and suppresses cell migration.
Li JP, Fu YN, Chen YR, Tan TH
The Journal of biological chemistry 2010 Feb 19;285(8):5472-8
The Journal of biological chemistry 2010 Feb 19;285(8):5472-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PTK2 monoclonal antibody (M01), clone 2C3 Western Blot analysis of PTK2 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PTK2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PTK2 transfected lysate using anti-PTK2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PTK2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between STAT1 and PTK2. HeLa cells were stained with anti-STAT1 rabbit purified polyclonal 1:1200 and anti-PTK2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)