Antibody data

Product number
H00005747-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005747-M01, RRID:AB_463794
Product name
PTK2 monoclonal antibody (M01), clone 2C3
Provider product page
Abnova Corporation - H00005747-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PTK2.
Antigen sequence
EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIY
PGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDL
RGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEER
FLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ
Isotype
IgG
Antibody clone number
2C3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -