HPA001842

PTK2 antibody from Sigma-Aldrich
FADK, FAK, FAK1, PPP1R71
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001842
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001842, RRID:AB_1855891
Product name
Anti-PTK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001842
Antibody type
Polyclonal
Antigen
Focal adhesion kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDK
DRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLID
GYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSE
KQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDY
EIQRE
Storage
-20C
Provider Type Product Number
- No reagents -