HPA071892

OXT antibody from Atlas Antibodies
OT, OT-NPI, OXT-NPI

Antibody data

Product number
HPA071892
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA071892, RRID:AB_2732190
Product name
Anti-OXT
Provider product page
Atlas Antibodies - HPA071892
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKA
CGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -