HPA001466

PTPN6 antibody from Atlas Antibodies
HCP, HCPH, PTP-1C, SHP-1, SHP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001466
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001466, RRID:AB_1855930
Product name
Anti-PTPN6
Provider product page
Atlas Antibodies - HPA001466
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLD
CDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQ
FIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAH
AKASRTSSKHKEDVYENLHTKNKREEKVKKQRSAD
KEKSKGSLK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -