HPA001466

PTPN6 antibody from Sigma-Aldrich
HCP, HCPH, PTP-1C, SHP-1, SHP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001466
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001466, RRID:AB_1855930
Product name
Anti-PTPN6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001466
Antibody type
Polyclonal
Antigen
Tyrosine-protein phosphatase non-receptor type 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLD
CDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQ
FIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAH
AKASRTSSKHKEDVYENLHTKNKREEKVKKQRSAD
KEKSKGSLK
Storage
-20C
Provider Type Product Number
- No reagents -