Explore
Validate
LearnH00004360-M02
antibody from Abnova Corporation
Targeting: MRC1
bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004360-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004360-M02, RRID:AB_565555
- Product name
- MRC1 monoclonal antibody (M02), clone 5C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MRC1.
- Antigen sequence
TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQ
KFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYAC
DSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKN
IMLY- Isotype
- IgG
- Antibody clone number
- 5C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Macrophage polarisation changes within the time between diagnostic biopsy and tumour resection in oral squamous cell carcinomas--an immunohistochemical study.
Brief report: alternative activation of laser-captured murine hemophagocytes.
Increased malignancy of oral squamous cell carcinomas (oscc) is associated with macrophage polarization in regional lymph nodes - an immunohistochemical study.
Expression of the mannose receptor CD206 in HIV and SIV encephalitis: a phenotypic switch of brain perivascular macrophages with virus infection.
Coronary atherosclerosis is associated with macrophage polarization in epicardial adipose tissue.
Weber M, Moebius P, Büttner-Herold M, Amann K, Preidl R, Neukam FW, Wehrhan F
British journal of cancer 2015 Jul 28;113(3):510-9
British journal of cancer 2015 Jul 28;113(3):510-9
Brief report: alternative activation of laser-captured murine hemophagocytes.
Canna SW, Costa-Reis P, Bernal WE, Chu N, Sullivan KE, Paessler ME, Behrens EM
Arthritis & rheumatology (Hoboken, N.J.) 2014 Jun;66(6):1666-71
Arthritis & rheumatology (Hoboken, N.J.) 2014 Jun;66(6):1666-71
Increased malignancy of oral squamous cell carcinomas (oscc) is associated with macrophage polarization in regional lymph nodes - an immunohistochemical study.
Wehrhan F, Büttner-Herold M, Hyckel P, Moebius P, Preidl R, Distel L, Ries J, Amann K, Schmitt C, Neukam FW, Weber M
BMC cancer 2014 Jul 21;14:522
BMC cancer 2014 Jul 21;14:522
Expression of the mannose receptor CD206 in HIV and SIV encephalitis: a phenotypic switch of brain perivascular macrophages with virus infection.
Holder GE, McGary CM, Johnson EM, Zheng R, John VT, Sugimoto C, Kuroda MJ, Kim WK
Journal of neuroimmune pharmacology : the official journal of the Society on NeuroImmune Pharmacology 2014 Dec;9(5):716-26
Journal of neuroimmune pharmacology : the official journal of the Society on NeuroImmune Pharmacology 2014 Dec;9(5):716-26
Coronary atherosclerosis is associated with macrophage polarization in epicardial adipose tissue.
Hirata Y, Tabata M, Kurobe H, Motoki T, Akaike M, Nishio C, Higashida M, Mikasa H, Nakaya Y, Takanashi S, Igarashi T, Kitagawa T, Sata M
Journal of the American College of Cardiology 2011 Jul 12;58(3):248-55
Journal of the American College of Cardiology 2011 Jul 12;58(3):248-55
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MRC1 monoclonal antibody (M02), clone 5C11. Western Blot analysis of MRC1 expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MRC1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
