HPA000849

CHD8 antibody from Sigma-Aldrich
DUPLIN, HELSNF1, KIAA1564
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000849
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000849, RRID:AB_1078509
Product name
Anti-CHD8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000849
Antibody type
Polyclonal
Antigen
Chromodomain-helicase-DNA-binding protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSSRRSQEMVTGGILGPGNHLLDSPSLTPGEYGDS
PVPTPRSSSAASMAEEEASAVSTAAAQFTKLRRGM
DEKEFTVQIKDEEGLKLTFQKHKLMANGVMGDGHP
LFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIP
VINKVDGTLLV
Storage
-20C
Provider Type Product Number
- No reagents -