Explore
Validate
LearnH00026512-M02
antibody from Abnova Corporation
Targeting: INTS6
DBI-1, DDX26, DDX26A, DICE1, HDB, INT6, Notchl2
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026512-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026512-M02, RRID:AB_464425
- Product name
- DDX26 monoclonal antibody (M02), clone 3D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DDX26.
- Antigen sequence
DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELK
AQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFL
QNVIKEASRFKKRMLIEQLENFLDEIHRRANQINH
INSN- Isotype
- IgG
- Antibody clone number
- 3D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged INTS6 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to INTS6 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to DDX26 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
