HPA001846

antibody from Atlas Antibodies

Targeting: INTS6 DBI-1, DDX26, DDX26A, DICE1, HDB, INT6, Notchl2

Antibody data

Submit

Validation data

Product number: HPA001846 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001846, RRID:AB_1847669
Product name: Anti-INTS6
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETT NDSIIHDVVENHVADQLSSDITPNAMDTEFSASSP ASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEE PRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTE LKAQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

INTS6 protein structure - HPA001846 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA001846 antibody. Corresponding INTS6 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows nuclear positivity in cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows weak nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN