HPA001552

INTS6 antibody from Sigma-Aldrich
DBI-1, DDX26, DDX26A, DICE1, HDB, INT6, Notchl2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001552
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001552, RRID:AB_1078659
Product name
Anti-INTS6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001552
Antibody type
Polyclonal
Antigen
Integrator complex subunit 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYELEPSPLTQFILERKSPQTCWQVYVSNSAKYSE
LGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDD
LFKVHKAKPTLKWRQSFESYLKTMPPYYLGPLKKA
VRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKI
ES
Storage
-20C
Provider Type Product Number
- No reagents -