HPA003494

LCK antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003494
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003494, RRID:AB_1852751
Product name
Anti-LCK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003494
Antibody type
Polyclonal
Antigen
Proto-oncogene tyrosine-protein kinase LCK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGT
LLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALH
SYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTT
GQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQ
LLAPGNTHGS
Storage
-20C
Provider Type Product Number
- No reagents -