HPA015788

IKBKE antibody from Sigma-Aldrich
IKK-i, IKKE, KIAA0151
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015788
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015788, RRID:AB_1851566
Product name
Anti-IKBKE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015788
Antibody type
Polyclonal
Antigen
Inhibitor of nuclear factor kappa-B kinase subunit epsilon recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTH
GKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESL
SKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRK
DLLLHMQELCEGMKLLASDLLDNNRIIERLN
Storage
-20C
Provider Type Product Number
- No reagents -